PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 483aa    MW: 52773.4 Da    PI: 7.747
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34636.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.6e-40102161261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  KHN34636.1 102 PDKILQCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRKNKHL 161
                 7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3090159IPR003851Zinc finger, Dof-type
PfamPF027012.0E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MSQKEKGPGI RLFGRKIPVP ECQIPANSGP TDTCCSIKKT ELKIPSECGE NSEQQENSSD  60
SRDSKQESQH KVQENEPIVN PKPVEDNMET GSSDQDKVLK KPDKILQCPR CNSMDTKFCY  120
FNNYNVNQPR HFCKNCQRYW TAGGTMRNVP IGAGRRKNKH LASQYQHIIV TSDGIPASRL  180
ETTDSSGLQQ QHIASLESSV SFRSSADNGT VLKFGTDTPL CKSMDSMLNL RDQRRCADAS  240
SISCVEYRGE PSLCGSSVMT NGAQGNELSE HNTSNWLQCY PVPPWVLPYP GWNNVNSMEA  300
VHRSSAPMCN PYNNTGPTAM QWCPTPMVAI PGMCPPSIPL QFVPPSYWSG TPLWNAGTGA  360
VSIGSNACLS PTSSTNNSCC SGNGSPTLGK HTRDTVCTDE EKSEKCVLVP KTIRIEAPNE  420
ASKSPIIRAT LAIKLDKQQF VSNGDILKKI EPKEGKDRVL GASQILEANP AAISRAHAFQ  480
ESL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939660.0BT093966.1 Soybean clone JCVI-FLGm-18A13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304603.10.0cyclic dof factor 3-like
TrEMBLA0A0B2RJ520.0A0A0B2RJ52_GLYSO; Dof zinc finger protein DOF5.2
STRINGGLYMA19G29610.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-59cycling DOF factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]